PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_09805
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family GATA
Protein Properties Length: 200aa    MW: 22221 Da    PI: 8.2177
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_09805genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.11e-17115148134
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                 C++C + +Tp+WR gp+g+ktLCnaCG++y + +
  PEQU_09805 115 CRHCEAQETPQWRLGPEGPKTLCNACGVRYNSGR 148
                 ******************************9877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004013.7E-12109159IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.082109144IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.1E-13113146IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577167.6E-14113172No hitNo description
CDDcd002022.69E-13114171No hitNo description
PfamPF003201.0E-15115149IPR000679Zinc finger, GATA-type
PROSITE patternPS003440115140IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MIGLPAPSEL LADDSLFFDF SGDPNCNPIA PTPLLFSEIP DADIDQRPGL SVDGEEEELE  60
WLANKDAFPP LETYFDPVSG PPFRPPARAR SGGRRRRRKA LPAFEPSPAT ERKKCRHCEA  120
QETPQWRLGP EGPKTLCNAC GVRYNSGRLV PEYRPANSPT FSPAIHSNSH RQVMLIRRRK  180
YGGGGGGGWR PTLRHQSESF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009384051.16e-45PREDICTED: GATA transcription factor 1-like
SwissprotP697815e-33GAT12_ARATH; GATA transcription factor 12
TrEMBLM0RSZ41e-44M0RSZ4_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P17140_0014e-44(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP59623656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.22e-33GATA transcription factor 11